PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.011G030900.9
Common NameB456_011G030900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ARF
Protein Properties Length: 682aa    MW: 74557.9 Da    PI: 6.8118
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.011G030900.9genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B378.28.8e-25138239199
                         EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85 
                         f+k+lt sd++++g +++p++ ae++      ++ ++ s++l+ +d++g +W++++iyr++++r++lt+GW+ Fv+ ++L +gD v+F   
  Gorai.011G030900.9 138 FCKTLTASDTSTHGGFSVPRRAAEDCfppldyDQ-QRPSQELVAKDLHGVEWRFRHIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFL-- 225
                         99****************************9743.345679************************************************.. PP

                         SSSEE..EEEEE-S CS
                  B3  86 grsefelvvkvfrk 99 
                         + +++el+++++r+
  Gorai.011G030900.9 226 RGEDGELRLGIRRA 239
                         449999*****996 PP

2Auxin_resp119.92.1e-39264345182
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                         a+ha+s+ksvF+++YnPras+seF+v+v k++k+l++++svGmRfkm+fete+++err sG+++g+sdldpvrWp+SkW++L
  Gorai.011G030900.9 264 AVHAISMKSVFSIYYNPRASSSEFIVPVCKFRKSLDRSFSVGMRFKMRFETENAPERRSSGLITGTSDLDPVRWPGSKWKCL 345
                         79*******************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.2E-42134245IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.1E-40135241IPR015300DNA-binding pseudobarrel domain
CDDcd100173.50E-23136238No hitNo description
PROSITE profilePS5086313.465138240IPR003340B3 DNA binding domain
SMARTSM010198.4E-24138240IPR003340B3 DNA binding domain
PfamPF023629.5E-23138239IPR003340B3 DNA binding domain
PfamPF065075.1E-34264345IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010050Biological Processvegetative phase change
GO:0010158Biological Processabaxial cell fate specification
GO:0010582Biological Processfloral meristem determinacy
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 682 aa     Download sequence    Send to blast
MGCLIDLNAT EEDETPSSCS LSPSSVLSAS GFSSSVCLEL LHACVGPLIS LPKKGSVVVY  60
FPQGHLEQAP EFSGLASVYD LPPHVFCRVL DVKLHAEGAT DEVYAQVSLV PDNEKLQEVD  120
GEDEDAEADM KLATPHMFCK TLTASDTSTH GGFSVPRRAA EDCFPPLDYD QQRPSQELVA  180
KDLHGVEWRF RHIYRGQPRR HLLTTGWSAF VNKKKLVSGD AVLFLRGEDG ELRLGIRRAA  240
QIKNGASFLS LCSKQLNRST FADAVHAISM KSVFSIYYNP RASSSEFIVP VCKFRKSLDR  300
SFSVGMRFKM RFETENAPER RSSGLITGTS DLDPVRWPGS KWKCLSVRWD DIDANKHGRV  360
SHWEIELSGS ISSSNCLLSP CSKRNRVGLP SGKPEFMVPD GIGAPDFGEP LRFQKVLQGQ  420
EILGFSTLYN SADSHNMHWS EIRRCFPGSN GSGIATIGNV GRDPPLNPVI SYKGVGFGES  480
FGFHKVLQGQ EIFLSSLYRR GSTMEETRGN DSAGLPNVGQ MSGTRSGWSS SMQGYNTHSP  540
VQPSAQVSSP SSVLMFQQAS NPVPNFNPTR NFNQEMERGV SSFRVPETYG AKLLSSSISE  600
HDSQPLAAQP SFGTNQELAS CKSSCRLFGF SLTEGDLDAT KEDNMVHATL SLGRGSLLPC  660
IGENFHPNPP AVASTVWKQL Y*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldx_A1e-1143237615363Auxin response factor 1
4ldx_B1e-1143237615363Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00021PBMTransfer from AT2G33860Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012456157.10.0PREDICTED: auxin response factor 3-like isoform X4
SwissprotO236610.0ARFC_ARATH; Auxin response factor 3
TrEMBLA0A0D2T1N10.0A0A0D2T1N1_G
STRINGPOPTR_0011s05830.10.0(Populus trichocarpa)
STRINGVIT_10s0003g00420.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33860.10.0ARF family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]